PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS504134.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 110aa    MW: 12643.7 Da    PI: 11.5502
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS504134.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.58.1e-3053102251
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  EcS504134.10  53 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 102
                   9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.42E-1550106IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-2651102IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2253104IPR006447Myb domain, plants
PfamPF002491.2E-654102IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
RFGGLSAYQL HQYHHHHHHH SQYAVIGSSE ASHGMMRSRF VSKLPVKRSM RAPRMRWTST  60
LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQVIIITRSK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062307.13e-67PREDICTED: transcription repressor KAN1 isoform X1
RefseqXP_010062308.13e-67PREDICTED: transcription repressor KAN1 isoform X2
SwissprotQ93WJ91e-40KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A059BU053e-67A0A059BU05_EUCGR; Uncharacterized protein
TrEMBLA0A059BUZ63e-67A0A059BUZ6_EUCGR; Uncharacterized protein
STRINGPOPTR_0017s02220.11e-46(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-38G2-like family protein